Skip to product information
1 of 1
BSA Conjugated Pramlintide (PLT) TRV-042375-01

BSA Conjugated Pramlintide (PLT)

Size

SKU:TRV-042375-01

Regular price $120.00
Regular price Sale price $120.00
Sale Sold out
Shipping calculated at checkout.
Quantity

BSA Conjugated Pramlintide (PLT) is a premium-quality life science research product supplied by Torvigen for laboratory and scientific applications.

View full details

Product specifications

Alternative Name Symlin
Name Synonym Pramlintide
Applications Immunogen; SDS-PAGE; WB.
Organism Species Pan-species (General)
Form Freeze-dried powder
Buffer PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
Tag N-terminal His Tag
Fragment KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY- (NH2)
Source Protein conjugation
Expression System Protein conjugation
Calculated Molecular Weight > 66 KDa
Observed Molecular Weight >66KDa
Purity > 90%