Skip to product information
1 of 1
BSA Conjugated Exenatide (EXT) TRV-042386-01

BSA Conjugated Exenatide (EXT)

Size

SKU:TRV-042386-01

Regular price $120.00
Regular price Sale price $120.00
Sale Sold out
Shipping calculated at checkout.
Quantity

BSA Conjugated Exenatide (EXT) is a premium-quality life science research product supplied by Torvigen for laboratory and scientific applications.

View full details

Product specifications

Alternative Name Byetta; Bydureon; Exendin-4
Name Synonym Exenatide
Uniprot P26349
Applications Immunogen; SDS-PAGE; WB.
Organism Species Pan-species (General)
Form Freeze-dried powder
Buffer PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
Tag N-terminal His Tag
Fragment HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Source Protein conjugation
Expression System Protein conjugation
Calculated Molecular Weight > 66 KDa
Purity > 90%